Thymosin Beta-4 (TB500) 2mg

Product Overview

Thymosin Beta-4 (commonly referred to as TB500 in its synthetic form) is a peptide of significant interest within laboratory research focused on cellular repair, tissue regeneration, and actin regulation. TB500 is the synthetic analogue of the naturally occurring peptide Thymosin Beta-4, which is present in nearly all human and animal cells.

The 2mg format provides researchers with a lower-quantity option while maintaining the same molecular structure and research applicability as larger vial sizes.

---

Understanding Thymosin Beta-4 (TB500)

TB500 is a 43-amino-acid peptide involved in the regulation of actin, a protein essential for cell structure, movement, and division. Actin plays a fundamental role in wound repair, muscle tissue maintenance, and cellular signalling, making TB500 a widely studied compound in experimental research settings.

Naturally occurring Thymosin Beta-4 is found throughout the body, including muscle tissue, blood cells, and areas undergoing tissue repair. The synthetic TB500 peptide enables controlled investigation of these biological processes.

---

Mechanism of Action (Research Context)

Within laboratory models, TB500 is associated with:

• Regulation of actin polymerisation

• Support of cell migration and differentiation

• Involvement in angiogenesis (new blood vessel formation)

• Modulation of inflammatory signalling pathways

These mechanisms underpin ongoing research into cellular repair, regeneration, and inflammation-related pathways.

---

Areas of Research Interest

Research involving TB500 commonly focuses on:

• Tissue repair and regeneration mechanisms

• Muscle and connective tissue research

• Inflammatory response modulation

• Cellular migration and proliferation

• Angiogenesis-related studies

• Hair follicle biology research

All applications remain strictly experimental and confined to laboratory research environments.

---

Conclusion

Thymosin Beta-4 (TB500) is a versatile and extensively researched peptide within cellular and molecular biology. Its role in actin regulation and tissue repair pathways makes it a valuable research tool for studying fundamental biological processes. The 2mg presentation offers flexibility for controlled experimental use while maintaining the same research integrity as larger formats.

---

Technical Details

• Synonyms: Thymosin Beta-4, Tβ4, Beta-Thymosin 4, Timbetasin

• Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

• IUPAC Condensed: Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser

• Molecular Weight: ~4,963 g/mol

• CAS Number: 77591-33-4

• PubChem CID: 16132341

• Reference: PubChem Link

---

Storage & Stability

• Stability: Store lyophilised peptide at -20 °C.

• Aliquot after reconstitution to avoid repeated freeze–thaw cycles.

• Reconstituted peptide may be stored at 4 °C for a limited period.

• Lyophilised material remains stable until expiry when stored at -20 °C.

• Source: Biosynthesis

• Reconstitution: Reconstitute with bacteriostatic water.

---

Usage Disclaimer

This product is supplied for laboratory research purposes only.
Thymosin Beta-4 (TB500) sold by Pure Peptides UK is intended exclusively for scientific research and educational use. Purchase and use are restricted to licensed researchers.